PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G47870.1
Common NameASL29, LBD27, SCP, T23J7.200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 328aa    MW: 37333.5 Da    PI: 5.7248
Description LOB domain-containing protein 27
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G47870.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601216.7e-38361361101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e+++++am+s+++++ +r r Pv+G++gv ++lq  +  +++el++++
  AT3G47870.1  36 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILEKLDETQKPEAMKSIIFQSYVRDRSPVHGCLGVTQQLQYMIWFAEEELKAVN 133
                  7**********************************************************************************************999 PP

       DUF260  99 eel 101
                  ++l
  AT3G47870.1 134 SQL 136
                  875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.00235136IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-3436133IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
GO:0003674Molecular Functionmolecular_function
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0020048anatomymicrospore
PO:0025281anatomypollen
PO:0001013developmental stageH late unicellular microspore stage
PO:0001059developmental stageJ bicellular pollen stage
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MSNTKHIHKG LQERLLDLLL IALIVYMTLK GGTSGACAAC KYQRRRCAAD CPLAPYFPAE  60
QPKLFQNVHR LFGVRSIVKI LEKLDETQKP EAMKSIIFQS YVRDRSPVHG CLGVTQQLQY  120
MIWFAEEELK AVNSQLQLYR SQPQNGQNQN QNHNHNQMIH ELGSDHNKQQ EDVTSQQLDL  180
GMGLNVNNNQ SNVVTPFFSS LLPVSETQQP QMSYTYSCSE VNNNGYSPPA YNTDSGKEIL  240
TNNNNVWGDQ NRFLYNNNNG GGYSNQNESC HEMKSNGVMA IQSQLVNLQM VSNHQRVEEE  300
EADHEYDELH QFLDIIDDRQ SFGDSKEA
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402555310.0
Expression AtlasAT3G47870-
AtGenExpressAT3G47870-
Functional Description ? help Back to Top
Source Description
TAIRRequired for normal cell division during pollen development. Mutant has extra cell in pollen of vegetative cell identity. Male gametophytic mutation.
Function -- GeneRIF ? help Back to Top
  1. The SIDECAR POLLEN gene, a member of the LBD/ASL family, delays the timing of microspore division and alters division orientation.
    [PMID: 21105930]
  2. SCP is a microspore-specific member of the LOB/AS2 domain family (LBD27/ASL29) showing that a plant-specific regulator plays a key role in oriented division of polarized microspores.
    [PMID: 21364317]
  3. A combinatorial role of LBD10 with LBD27 is crucial for male gametophyte development in Arabidopsis. LBD10 and LBD27 interact to form a heterodimer for nuclear localization.
    [PMID: 25611322]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G47870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G47870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738620.0AB473862.1 Arabidopsis thaliana ASL29 mRNA for ASYMMETRIC LEAVES2-like 29 protein, complete cds.
GenBankAL0497460.0AL049746.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T23J7.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190371.10.0LOB domain-containing protein 27
SwissprotQ9STS60.0LBD27_ARATH; LOB domain-containing protein 27
TrEMBLD7LRG70.0D7LRG7_ARALL; Putative uncharacterized protein
STRINGAT3G47870.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Representative plantOGRP6016318
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  4. Oh SA,Park KS,Twell D,Park SK
    The SIDECAR POLLEN gene encodes a microspore-specific LOB/AS2 domain protein required for the correct timing and orientation of asymmetric cell division.
    Plant J., 2010. 64(5): p. 839-50
    [PMID:21105930]
  5. Oh SA,Twell D,Park SK
    SIDECAR POLLEN suggests a plant-specific regulatory network underlying asymmetric microspore division in Arabidopsis.
    Plant Signal Behav, 2011. 6(3): p. 416-9
    [PMID:21364317]
  6. Kim MJ,Kim M,Lee MR,Park SK,Kim J
    LATERAL ORGAN BOUNDARIES DOMAIN (LBD)10 interacts with SIDECAR POLLEN/LBD27 to control pollen development in Arabidopsis.
    Plant J., 2015. 81(5): p. 794-809
    [PMID:25611322]
  7. Chen YC,McCormick S
    sidecar pollen, an Arabidopsis thaliana male gametophytic mutant with aberrant cell divisions during pollen development.
    Development, 1996. 122(10): p. 3243-53
    [PMID:8898236]